PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.15996s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 359aa    MW: 40657 Da    PI: 6.3802
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.15996s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.7e-32199254156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k r++W++eLH+rF++a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Araha.15996s0001.1.p 199 KHRRCWSQELHRRFLNALKQLGGPHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 254
                           68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.226196256IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-28197257IPR009057Homeodomain-like
SuperFamilySSF466891.17E-17197256IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-27199254IPR006447Myb domain, plants
PfamPF002492.8E-7201252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MIKNISTMKN YNQKRERCCE LVEALEEERR KINVFQREFP LCLELVTQAI EAYKREISGT  60
TTDNVYGQSE CSEQTTGECG RVLDLFIPIK HSSTFVEEVE EEVDDKDDDD DDDDEHESHE  120
TNIDFDDKNM KSEWLKSVQL WNQPDAVVSN NRQDHSQETT EMMVELIKRN DEAAEKNNNI  180
QSPATTSGGG GGGRRGQRKH RRCWSQELHR RFLNALKQLG GPHVATPKQI RELMKVDGLT  240
NDEVKSHLQK YRLHARRPSQ TTPNNRNSQT QHFVVVGGIW VPQTNHSTAN VVASGETTTG  300
IYGPMVNPLS SEWPSHSNFG RTISEDRSRS CSNKGIFRCS SPAMSSSTRT KTKDAKIS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0855700.0AY085570.1 Arabidopsis thaliana clone 157740 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002875280.10.0myb family transcription factor
TrEMBLD7LQU60.0D7LQU6_ARALL; Myb family transcription factor
STRINGfgenesh1_pm.C_scaffold_50002650.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136001827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25790.10.0G2-like family protein